PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.126810.1
Common NameCsa_1G074970, LOC101211189
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 352aa    MW: 38945.5 Da    PI: 7.7007
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.126810.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.76.1e-3967126261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     +++ l+cprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+ 
  Cucsa.126810.1  67 QQEPLRCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRL 126
                     57889*****************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2769125IPR003851Zinc finger, Dof-type
PfamPF027011.8E-3369125IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4671125IPR003851Zinc finger, Dof-type
PROSITE patternPS01361073109IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MLGNCEKMVL ISSSPNQWPQ MMKNNNHPTS LDHDHQKGLN LIGSSSGIIM DNNKQQDQKT  60
QQKQQHQQEP LRCPRCDSSN TKFCYYNNYS LSQPRHFCKA CKRYWTRGGT LRNVPVGGGC  120
RKNKRLKRPT ISSTTTTVTH SSSSPAPTAP DSTSSSSTSC NTNPLHNIFY GSTSDLNLPF  180
SGYDHHHHNH LQTHLNALGL GFSSPNIDHR DFNLNGFNSS SLLSGYSSLF GNNNNNPSSN  240
STSISSLLAS KFDPNLFGNL ASSQPFDDHV MGSNGGDQLG LNVKDVKLED GMKRLNWEDD  300
GHQQQNHQTD NEIVAQSNDD HHNSLFANNW TSQNWHHDPP NLASSITSSL I*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004146609.10.0PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLA0A0A0LV580.0A0A0A0LV58_CUCSA; Uncharacterized protein
STRINGVIT_10s0003g00040.t012e-60(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.22e-34Dof family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]